(data stored in ACNUC7421 zone)

EMBL: CP001111.PE66

CP001111.PE66        Location/Qualifiers
FT   CDS             80177..81235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49771"
FT                   /db_xref="GOA:B4SRQ1"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ1"
FT                   /protein_id="ACF49771.1"
FT                   /translation="MSATSTPERQAARAAGLRYVDDTQPGISRRRAGKGFSYRDADGRA
FT                   LRDATTLQRIRALAIPPAYTAVWICAHANGHLQATGRDARGRKQYRYHADWAKERDAGK
FT                   FDRIIAFGEALPTLRRRLSRDLKRPGFPREKVLAVVVALLADTLVRVGNETYAQQNRSF
FT                   GLTTLRNRHLELLRGGRVRMRFRGKSGQLQEVTVGDRKLGLLVRRLQQLPGQALFQYHD
FT                   DEGALQPVDSGAVNDYLREVMGEDFTAKDFRTWGGTVAAVQAFAATELPEPASQRALAQ
FT                   AQRAVVCEVASLLGNTPAVCRKAYIDPCVFAGWERGELAKLAGLRGPRQWEQATLRVLR
FT                   RARRLNRSRQPQ"
     MSATSTPERQ AARAAGLRYV DDTQPGISRR RAGKGFSYRD ADGRALRDAT TLQRIRALAI        60
     PPAYTAVWIC AHANGHLQAT GRDARGRKQY RYHADWAKER DAGKFDRIIA FGEALPTLRR       120
     RLSRDLKRPG FPREKVLAVV VALLADTLVR VGNETYAQQN RSFGLTTLRN RHLELLRGGR       180
     VRMRFRGKSG QLQEVTVGDR KLGLLVRRLQ QLPGQALFQY HDDEGALQPV DSGAVNDYLR       240
     EVMGEDFTAK DFRTWGGTVA AVQAFAATEL PEPASQRALA QAQRAVVCEV ASLLGNTPAV       300
     CRKAYIDPCV FAGWERGELA KLAGLRGPRQ WEQATLRVLR RARRLNRSRQ PQ               352
//

If you have problems or comments...

PBIL Back to PBIL home page