(data stored in ACNUC7421 zone)

EMBL: CP001111.PE7

CP001111.PE7         Location/Qualifiers
FT   CDS             9511..10698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0007"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: xac:XAC0007
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR11"
FT                   /protein_id="ACF49712.1"
FT                   /translation="MIFRNHKAVLSVLVATALTGAVVTDAFAQSSRSSERGNRGGKQAK
FT                   AEALYPNATRQEPTVKASAKMGSKLQKMIDSYNKEKFPETRTQADAILADSAANEYDKS
FT                   LAAQLASQAAYQTEDTPAAVAYLKQVLQFNGLDNNGHFQSMLMLGQLELQEDKTAEGLA
FT                   TLDKYFAESKSTKPEELIAKGQALYQLERYQEAIPVLKQAIAGSAEPKDNWNQLLMAAL
FT                   SEAGQSGEAVKEAEALAAKNPSDKKAQLNLASMYMQADQMDKAATVMDKLRSSGQLTEE
FT                   REYKQLYSIYANTEHKEKDVIAVINEGLQKGILKPDYQVYLALAQSYYYSDQVPQAIDA
FT                   WQKAAPLSKDGETYLNLARVLHAEGRVPEAKQAAQQALAKGVKNQADAKKIINLK"
     MIFRNHKAVL SVLVATALTG AVVTDAFAQS SRSSERGNRG GKQAKAEALY PNATRQEPTV        60
     KASAKMGSKL QKMIDSYNKE KFPETRTQAD AILADSAANE YDKSLAAQLA SQAAYQTEDT       120
     PAAVAYLKQV LQFNGLDNNG HFQSMLMLGQ LELQEDKTAE GLATLDKYFA ESKSTKPEEL       180
     IAKGQALYQL ERYQEAIPVL KQAIAGSAEP KDNWNQLLMA ALSEAGQSGE AVKEAEALAA       240
     KNPSDKKAQL NLASMYMQAD QMDKAATVMD KLRSSGQLTE EREYKQLYSI YANTEHKEKD       300
     VIAVINEGLQ KGILKPDYQV YLALAQSYYY SDQVPQAIDA WQKAAPLSKD GETYLNLARV       360
     LHAEGRVPEA KQAAQQALAK GVKNQADAKK IINLK                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page