(data stored in ACNUC7421 zone)

EMBL: CP001111.PE72

CP001111.PE72        Location/Qualifiers
FT   CDS             complement(86394..87341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0072"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: csa:Csal_2540 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49777"
FT                   /db_xref="GOA:B4SRQ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ7"
FT                   /protein_id="ACF49777.1"
FT                   /translation="MQVYSCAELMSAAHALGGRVDFESGLPDALPVLAGWQQVQSMDSG
FT                   LVLYLSRSQDMVGGRSQNCLPAGLTASFLLQGQAEVVITNQRLQMDSRRAGSPAMLVHL
FT                   REEEAFQRHWQAGREETKVSLHLGQDWLSRQLDGIASAGLTRLRLSHARNQAWQPPAPL
FT                   LRRAAALFGAETAEPPLLASLQRESFALEVAASVVRSVIAEREAPAPSAHLRRCVDQLQ
FT                   QWLQSGEADGLTINQMARRLGTNAVDLQSTFQQLHGSSIAAWLRALRLQRAHDALLQRR
FT                   VSVDVAASLAGYAHTSSFSAAFKRQFGRSPSQIR"
     MQVYSCAELM SAAHALGGRV DFESGLPDAL PVLAGWQQVQ SMDSGLVLYL SRSQDMVGGR        60
     SQNCLPAGLT ASFLLQGQAE VVITNQRLQM DSRRAGSPAM LVHLREEEAF QRHWQAGREE       120
     TKVSLHLGQD WLSRQLDGIA SAGLTRLRLS HARNQAWQPP APLLRRAAAL FGAETAEPPL       180
     LASLQRESFA LEVAASVVRS VIAEREAPAP SAHLRRCVDQ LQQWLQSGEA DGLTINQMAR       240
     RLGTNAVDLQ STFQQLHGSS IAAWLRALRL QRAHDALLQR RVSVDVAASL AGYAHTSSFS       300
     AAFKRQFGRS PSQIR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page