(data stored in ACNUC7421 zone)

EMBL: CP001111.PE73

CP001111.PE73        Location/Qualifiers
FT   CDS             87475..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49778"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ8"
FT                   /protein_id="ACF49778.1"
FT                   /translation="MGLVINEAVVLRAVFHGAVDAHQIRYWLDRVQALIDAHRPFYFVA
FT                   STAPGATFCDDYRALQAVWYKQYKAAFRRYCRGLVRIASDAADQQRLDTPALHAAWAVP
FT                   YFVTADAGAGMRWIGEHLEQADAH"
     MGLVINEAVV LRAVFHGAVD AHQIRYWLDR VQALIDAHRP FYFVASTAPG ATFCDDYRAL        60
     QAVWYKQYKA AFRRYCRGLV RIASDAADQQ RLDTPALHAA WAVPYFVTAD AGAGMRWIGE       120
     HLEQADAH                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page