(data stored in ACNUC7421 zone)

EMBL: CP001111.PE74

CP001111.PE74        Location/Qualifiers
FT   CDS             87851..89071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0074"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fph:Fphi_0920 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49779"
FT                   /db_xref="GOA:B4SRQ9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ9"
FT                   /protein_id="ACF49779.1"
FT                   /translation="MRTERAAASPFGLGVIVALYMAHALPLYFYNVAVPAILRSQGVDL
FT                   RWIGMLSLLYLPWALKFLWAPLVDRWHLPALGRRRSWLWLTQLLLLAGILVLAFTGLDH
FT                   GLVVFVLVGMWISSIAATQDIAIDGYTVEALAPAEHRLGSMAQSVGVALGSMIGGAGVL
FT                   WLYETRGWSVALLSLAAMSALTLLAVQRINETPARPDAPRPSILRALRRRELRWALLLI
FT                   VLYRLVEAPAMAMINPLLVDQQFSLTEIGLLISVGGAGTGMLAAVGAAWLLKQRRAEQL
FT                   LMHAGWWRTVLYVLLALMLYSGAMASSRWGLGVLVIALLALRYVAMTSLYALFMRVSSR
FT                   AQAGTDFTLLVCFELLVNFIGGALSGFLAKGLGYPIYYIALAAVSALGLLLCRPLMRRF
FT                   AAPTNSP"
     MRTERAAASP FGLGVIVALY MAHALPLYFY NVAVPAILRS QGVDLRWIGM LSLLYLPWAL        60
     KFLWAPLVDR WHLPALGRRR SWLWLTQLLL LAGILVLAFT GLDHGLVVFV LVGMWISSIA       120
     ATQDIAIDGY TVEALAPAEH RLGSMAQSVG VALGSMIGGA GVLWLYETRG WSVALLSLAA       180
     MSALTLLAVQ RINETPARPD APRPSILRAL RRRELRWALL LIVLYRLVEA PAMAMINPLL       240
     VDQQFSLTEI GLLISVGGAG TGMLAAVGAA WLLKQRRAEQ LLMHAGWWRT VLYVLLALML       300
     YSGAMASSRW GLGVLVIALL ALRYVAMTSL YALFMRVSSR AQAGTDFTLL VCFELLVNFI       360
     GGALSGFLAK GLGYPIYYIA LAAVSALGLL LCRPLMRRFA APTNSP                      406
//

If you have problems or comments...

PBIL Back to PBIL home page