(data stored in ACNUC7421 zone)

EMBL: CP001111.PE79

CP001111.PE79        Location/Qualifiers
FT   CDS             complement(94311..95333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49784"
FT                   /db_xref="GOA:B4SRR4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR4"
FT                   /protein_id="ACF49784.1"
FT                   /translation="MSLSLDKLRLLRKQAGDPKAVTPAAPEPPPAAPAPVAANDARQPP
FT                   AERSVFAWVEQEIRHKATGAAASTPTPAPLRRPEVGSLHRLLGLRTRGGPAPARASAQD
FT                   RQLPGEEIAPGLFLIESLQPQPIPAQSMSLDFARREGEHVAPRDLLFFDTETTGLAGGT
FT                   GTRAFMIGAADWHVCPQRGEGLRIRQLLMSTMAAEDAMLATFASWLQPSTVFCSYNGRS
FT                   YDAPLLKARYRLARQRCPITALDHVDLLYPTRRRYRGTWENCKLSTIERQLLRVVREDD
FT                   LPGSEAPGAWLRFLRGGDAVNLRRVADHNHQDVVTLALLLQRLVREEQRERETLALVGQ
FT                   "
     MSLSLDKLRL LRKQAGDPKA VTPAAPEPPP AAPAPVAAND ARQPPAERSV FAWVEQEIRH        60
     KATGAAASTP TPAPLRRPEV GSLHRLLGLR TRGGPAPARA SAQDRQLPGE EIAPGLFLIE       120
     SLQPQPIPAQ SMSLDFARRE GEHVAPRDLL FFDTETTGLA GGTGTRAFMI GAADWHVCPQ       180
     RGEGLRIRQL LMSTMAAEDA MLATFASWLQ PSTVFCSYNG RSYDAPLLKA RYRLARQRCP       240
     ITALDHVDLL YPTRRRYRGT WENCKLSTIE RQLLRVVRED DLPGSEAPGA WLRFLRGGDA       300
     VNLRRVADHN HQDVVTLALL LQRLVREEQR ERETLALVGQ                             340
//

If you have problems or comments...

PBIL Back to PBIL home page