(data stored in ACNUC7421 zone)

EMBL: CP001111.PE8

CP001111.PE8         Location/Qualifiers
FT   CDS             10842..11510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0008"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: xac:XAC0008 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49713"
FT                   /db_xref="GOA:B4SR12"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR12"
FT                   /protein_id="ACF49713.1"
FT                   /translation="MTEQLVVHRYEQPDDKGLSWPRIVGIAFVIALHLAAFMMLLIPAV
FT                   APKAVAEKERNVMVTIVDAPPPPPPPPPPPPPTDTPPPPVKNLSPPKPSPVPPPPQAPV
FT                   VDVPEPRPSDIVTPPSPPSPPAPPTSIEASVDISSKAMNPPRYPPAAFRAGIQGEVILI
FT                   IDVDASGNVTNVTVEKSSRNRDLDRAAMEAARKWRFNAAEAGGKKAAGRVRVPVNFALN
FT                   "
     MTEQLVVHRY EQPDDKGLSW PRIVGIAFVI ALHLAAFMML LIPAVAPKAV AEKERNVMVT        60
     IVDAPPPPPP PPPPPPPTDT PPPPVKNLSP PKPSPVPPPP QAPVVDVPEP RPSDIVTPPS       120
     PPSPPAPPTS IEASVDISSK AMNPPRYPPA AFRAGIQGEV ILIIDVDASG NVTNVTVEKS       180
     SRNRDLDRAA MEAARKWRFN AAEAGGKKAA GRVRVPVNFA LN                          222
//

If you have problems or comments...

PBIL Back to PBIL home page