(data stored in ACNUC7421 zone)

EMBL: CP001111.PE82

CP001111.PE82        Location/Qualifiers
FT   CDS             98590..99264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49787"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR7"
FT                   /protein_id="ACF49787.1"
FT                   /translation="MFLRSICLLAALLPASAFADGIAGDGACRNGAFPSEQSRFALARV
FT                   VDAPRLYLLGDMDGCPAKGEPACRQRSYVVNGDTVVTGRDLGRYRCAFFPNKVGGSAGW
FT                   VDRSKLQALPVVVPSLQDWAGHWKDGDNGLRITVQGGQLHVEGDAYWPSANPTPEQRPY
FT                   GPNMGQVEARAAPRGADVEFVEDTCKVRVHSLGEVLIVADNRECGGMNVRFNGVYRRAG
FT                   TR"
     MFLRSICLLA ALLPASAFAD GIAGDGACRN GAFPSEQSRF ALARVVDAPR LYLLGDMDGC        60
     PAKGEPACRQ RSYVVNGDTV VTGRDLGRYR CAFFPNKVGG SAGWVDRSKL QALPVVVPSL       120
     QDWAGHWKDG DNGLRITVQG GQLHVEGDAY WPSANPTPEQ RPYGPNMGQV EARAAPRGAD       180
     VEFVEDTCKV RVHSLGEVLI VADNRECGGM NVRFNGVYRR AGTR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page