(data stored in ACNUC7421 zone)

EMBL: CP001111.PE83

CP001111.PE83        Location/Qualifiers
FT   CDS             complement(99364..101172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49788"
FT                   /db_xref="GOA:B4SRR8"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR8"
FT                   /protein_id="ACF49788.1"
FT                   /translation="MNASAVNLWIALALALIVVIASVRQLRGDTAHPGRRWIMIALQII
FT                   VAALLYFCLVPPTRQQPAGGLVVLGTDADKASALPASEGPLLLLPEAADIPGAQRVPDL
FT                   ATALRQHPASTLTLVGAGLAARDHDALLPPDVRWQAAPEPRGWIALQPPANVAPGARFD
FT                   VQAQARGAARAKAELLDPADSVVDRTDVAEDGRVKLSGIARAEGRSVFQLRLLDADGHV
FT                   VDSVPVPQQTLPAAPLRLMVRASAPGPELKYLRRWAADAGIRVQVQADTGAGVSVGDGA
FT                   VALDAASLARSDLLLLDERSLAALSAGQLAAVRQALREGLGVLVRGAGAPSASARQRLR
FT                   DLGLPVQGDGSSRTLELPGDGDSAVLAARRGPLAAGTLPTGYGEEADRSSHNAPLPALE
FT                   ALALQAPGSTALLQDGTGKAVGGWRAAGKGRIGLLPLTDSWRWVLAGRDDRHGELWSGV
FT                   VATLARAQGSADALWSPQPIGWAGERQSLCGVQAPLQVFNKRGDDVSLIVDGATSALRC
FT                   AGWWPREPGWQRLQHGDSVVWRYVFDPKDAPALHRQAMIDATTQALASSTSANALVMQH
FT                   VPGSRWPWWLAFVLCASLLWWLERRR"
     MNASAVNLWI ALALALIVVI ASVRQLRGDT AHPGRRWIMI ALQIIVAALL YFCLVPPTRQ        60
     QPAGGLVVLG TDADKASALP ASEGPLLLLP EAADIPGAQR VPDLATALRQ HPASTLTLVG       120
     AGLAARDHDA LLPPDVRWQA APEPRGWIAL QPPANVAPGA RFDVQAQARG AARAKAELLD       180
     PADSVVDRTD VAEDGRVKLS GIARAEGRSV FQLRLLDADG HVVDSVPVPQ QTLPAAPLRL       240
     MVRASAPGPE LKYLRRWAAD AGIRVQVQAD TGAGVSVGDG AVALDAASLA RSDLLLLDER       300
     SLAALSAGQL AAVRQALREG LGVLVRGAGA PSASARQRLR DLGLPVQGDG SSRTLELPGD       360
     GDSAVLAARR GPLAAGTLPT GYGEEADRSS HNAPLPALEA LALQAPGSTA LLQDGTGKAV       420
     GGWRAAGKGR IGLLPLTDSW RWVLAGRDDR HGELWSGVVA TLARAQGSAD ALWSPQPIGW       480
     AGERQSLCGV QAPLQVFNKR GDDVSLIVDG ATSALRCAGW WPREPGWQRL QHGDSVVWRY       540
     VFDPKDAPAL HRQAMIDATT QALASSTSAN ALVMQHVPGS RWPWWLAFVL CASLLWWLER       600
     RR                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page