(data stored in ACNUC7421 zone)

EMBL: CP001111.PE88

CP001111.PE88        Location/Qualifiers
FT   CDS             complement(106374..107081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49793"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS3"
FT                   /protein_id="ACF49793.1"
FT                   /translation="MDRRACLRWLAAAASAAALPAFAQAGPRSSRYDFWFTRLQYDSGD
FT                   WDVDARMPSNLITSLIDYTSLRVDPQEHVVALADPRMLEAPFCYLAGHTLVEFNAAERQ
FT                   NFVRYVRNGGFVFVDDCNHDIDGLFATSFEAQMGRLFGPKALQKLPNSHALYRSFFRFP
FT                   DGPPATSFELNGWGDDLVHDYLKGIEVDGRLGLLYSNKDYGCEWDYDWRNKRFLAEDNT
FT                   RFGVNIVMYALNN"
     MDRRACLRWL AAAASAAALP AFAQAGPRSS RYDFWFTRLQ YDSGDWDVDA RMPSNLITSL        60
     IDYTSLRVDP QEHVVALADP RMLEAPFCYL AGHTLVEFNA AERQNFVRYV RNGGFVFVDD       120
     CNHDIDGLFA TSFEAQMGRL FGPKALQKLP NSHALYRSFF RFPDGPPATS FELNGWGDDL       180
     VHDYLKGIEV DGRLGLLYSN KDYGCEWDYD WRNKRFLAED NTRFGVNIVM YALNN            235
//

If you have problems or comments...

PBIL Back to PBIL home page