(data stored in ACNUC7421 zone)

EMBL: CP001111.PE94

CP001111.PE94        Location/Qualifiers
FT   CDS             complement(114357..114614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0094"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rso:RSp1252 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49799"
FT                   /db_xref="GOA:B4SRS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS9"
FT                   /protein_id="ACF49799.1"
FT                   /translation="MDRPLHTVRTPQQLAPLMRAFRRQAGLSQAQLAAQLGISRQAVGA
FT                   LERDPASASFERLMRVWAVLGLEVRLQQRSPPETTSTLEW"
     MDRPLHTVRT PQQLAPLMRA FRRQAGLSQA QLAAQLGISR QAVGALERDP ASASFERLMR        60
     VWAVLGLEVR LQQRSPPETT STLEW                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page