(data stored in ACNUC7421 zone)

EMBL: CP001111.PE96

CP001111.PE96        Location/Qualifiers
FT   CDS             118628..119263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT1"
FT                   /protein_id="ACF49801.1"
FT                   /translation="MSVSGKILASVLLASGAATAWAAPALPAPQEFYFDSDLAATPMVA
FT                   IQGEGDELVTQLVKLRERGRRAVEATVQLASVAGAQGRSELAEQLYGEALKEASAQSSS
FT                   GRSVRWNYGWDLLRQGRVEAALEQWLSSAGNARTKPSWVPPTYALALWRLGQKQEAVQW
FT                   YAAAVRTEPSQWNTTANYGQLLPQWREDERATLAEVQQAWAAAPPVWP"
     MSVSGKILAS VLLASGAATA WAAPALPAPQ EFYFDSDLAA TPMVAIQGEG DELVTQLVKL        60
     RERGRRAVEA TVQLASVAGA QGRSELAEQL YGEALKEASA QSSSGRSVRW NYGWDLLRQG       120
     RVEAALEQWL SSAGNARTKP SWVPPTYALA LWRLGQKQEA VQWYAAAVRT EPSQWNTTAN       180
     YGQLLPQWRE DERATLAEVQ QAWAAAPPVW P                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page