(data stored in ACNUC7421 zone)

EMBL: CP001111.PE97

CP001111.PE97        Location/Qualifiers
FT   CDS             complement(119856..121340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0097"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: pap:PSPA7_0798 probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49802"
FT                   /db_xref="GOA:B4SRT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT2"
FT                   /protein_id="ACF49802.1"
FT                   /translation="MSELQDLSALIRANTPLIVIETQDEGRIVELFRQTLMHVWRALHR
FT                   WSITEGLRRIDLDSEDPAVGPPDASAALQMIRQADQRGVYLLLDFHPYLGYASHQRALR
FT                   DLIQRRHSEPHVLVLIGAKVELPAELEALAVRFNPRLPDANALLKMLREEADAYAREHG
FT                   GRRVEVDSEAVKKILKNLQGLSLVDARRIARQLIYADGALRDDDLPQLARLKFELLNRS
FT                   GHLFFEHDSARFGDVAGANRLKRWINQRRVAFIAGSAPAGLDPPRGMLLLGVQGCGKSM
FT                   LAKATAAGFGVPLLRLDVGALYNKYHGETEANLRQALASAEQLAPCVLWMDEIEKGLAS
FT                   GGEDGGVSRRVLGYLLTWMAERKAPVFIVATANQVHELPAELLRKGRFDEIFFVDLPSP
FT                   EVRVELLRLHLGRRQLNADDFALPALAAAANGFSGAEIEQAIVAGLYAAHAEGRPLDTE
FT                   LLMNEIRATRPLSVLMAEQVEALRAWASGRTVSADD"
     MSELQDLSAL IRANTPLIVI ETQDEGRIVE LFRQTLMHVW RALHRWSITE GLRRIDLDSE        60
     DPAVGPPDAS AALQMIRQAD QRGVYLLLDF HPYLGYASHQ RALRDLIQRR HSEPHVLVLI       120
     GAKVELPAEL EALAVRFNPR LPDANALLKM LREEADAYAR EHGGRRVEVD SEAVKKILKN       180
     LQGLSLVDAR RIARQLIYAD GALRDDDLPQ LARLKFELLN RSGHLFFEHD SARFGDVAGA       240
     NRLKRWINQR RVAFIAGSAP AGLDPPRGML LLGVQGCGKS MLAKATAAGF GVPLLRLDVG       300
     ALYNKYHGET EANLRQALAS AEQLAPCVLW MDEIEKGLAS GGEDGGVSRR VLGYLLTWMA       360
     ERKAPVFIVA TANQVHELPA ELLRKGRFDE IFFVDLPSPE VRVELLRLHL GRRQLNADDF       420
     ALPALAAAAN GFSGAEIEQA IVAGLYAAHA EGRPLDTELL MNEIRATRPL SVLMAEQVEA       480
     LRAWASGRTV SADD                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page