(data stored in ACNUC7421 zone)

EMBL: CP001111.PE98

CP001111.PE98        Location/Qualifiers
FT   CDS             121464..122093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0098"
FT                   /product="partition protein"
FT                   /note="KEGG: xcb:XC_0183 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49803"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT3"
FT                   /protein_id="ACF49803.1"
FT                   /translation="MKTILVAGSKGGVGKTTVATHLAAYAALQGKATVIADADPQGSST
FT                   RWAQRRAGLESAVLPIDVYRKKQWAQKLPDGTETVIIDAPAGALADDIPHFLDAADAVV
FT                   VPVLPSALDIEAIVGFLNSLAQNPRVHSRKLPVGLVLNRTKPWTQTSQQALQMLSEWPY
FT                   PVVAQLRDSQSYVVMTGLGRSLFDYRSAQVREHQADWEPLLSWLKL"
     MKTILVAGSK GGVGKTTVAT HLAAYAALQG KATVIADADP QGSSTRWAQR RAGLESAVLP        60
     IDVYRKKQWA QKLPDGTETV IIDAPAGALA DDIPHFLDAA DAVVVPVLPS ALDIEAIVGF       120
     LNSLAQNPRV HSRKLPVGLV LNRTKPWTQT SQQALQMLSE WPYPVVAQLR DSQSYVVMTG       180
     LGRSLFDYRS AQVREHQADW EPLLSWLKL                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page