(data stored in ACNUC7421 zone)

EMBL: CP001115.ALX

CP001115.ALX         Location/Qualifiers
FT   CDS             complement(102246..103268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alx"
FT                   /locus_tag="Deide_1p00590"
FT                   /product="putative TerC family protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47462"
FT                   /db_xref="GOA:C1D223"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C1D223"
FT                   /protein_id="ACO47462.1"
FT                   /translation="MEFLLDLWLGKPAWMWLMFITLVMALLAFDLGVLGKRREAQAASG
FT                   AGQPHEIGVKASLKLSLFYISVALLFGVWVWSTLGPQSGIEYLTGFAVEKALALDNVFV
FT                   ISVIFGALAIPRHLQHRVLVWGILGVIVLRGLMIGLGTALVTQFDWIMWVFGAFLLLTG
FT                   IKLLLARGGHSDAPDLERHPVVRLLKRIIPVSSELDGQKFLTRLPEAGGRRRLHATPLL
FT                   LALVLVEAADLVFAVDSIPAIFAITQDPFLVYTSNIFAILGLRALYFALDALIHRFEAL
FT                   KPALALVLMFIGGKIFYTQLFGKMDPALSLGITLSILAGGILTSLWKNRTPGPAAKPQL
FT                   "
     MEFLLDLWLG KPAWMWLMFI TLVMALLAFD LGVLGKRREA QAASGAGQPH EIGVKASLKL        60
     SLFYISVALL FGVWVWSTLG PQSGIEYLTG FAVEKALALD NVFVISVIFG ALAIPRHLQH       120
     RVLVWGILGV IVLRGLMIGL GTALVTQFDW IMWVFGAFLL LTGIKLLLAR GGHSDAPDLE       180
     RHPVVRLLKR IIPVSSELDG QKFLTRLPEA GGRRRLHATP LLLALVLVEA ADLVFAVDSI       240
     PAIFAITQDP FLVYTSNIFA ILGLRALYFA LDALIHRFEA LKPALALVLM FIGGKIFYTQ       300
     LFGKMDPALS LGITLSILAG GILTSLWKNR TPGPAAKPQL                             340
//

If you have problems or comments...

PBIL Back to PBIL home page