(data stored in ACNUC7421 zone)

EMBL: CP001115.CHEB

CP001115.CHEB        Location/Qualifiers
FT   CDS             80456..81496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="Deide_1p00470"
FT                   /product="putative protein-glutamate methylesterase (CheB
FT                   methylesterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47446"
FT                   /db_xref="GOA:C1D207"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR011247"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C1D207"
FT                   /protein_id="ACO47446.1"
FT                   /translation="MTDFPLVVIGASAGGVSALMKLCAQLPSSFPAAVLVVQHVSPAHP
FT                   SMLPRILSAAGTLHAIHPRDGQTLHPGMIYVAPPDHHLLVDGETVLLSRGPRENRSRPA
FT                   IDVLFRSAAVEAGSRVIGVVLTGNLDDGTSGLHVIKQAGGLAVVQDPDDAEFASMPRSA
FT                   LNAVKVDHVAPLSELGALLASLVDDRARNHRPTPLASEDVRRLEVELGVAREEHALSKG
FT                   VTRLGAPSPLTCPECHGTLIEIREGTLVRFRCHSGHAYTAGTLLTEVSESVESKAYQAL
FT                   RALGETVILLRQLSDQRQKQGDPAGAEAFLARAREVEASSEGIRALVRTTRALSVEKVE
FT                   RPDFDG"
     MTDFPLVVIG ASAGGVSALM KLCAQLPSSF PAAVLVVQHV SPAHPSMLPR ILSAAGTLHA        60
     IHPRDGQTLH PGMIYVAPPD HHLLVDGETV LLSRGPRENR SRPAIDVLFR SAAVEAGSRV       120
     IGVVLTGNLD DGTSGLHVIK QAGGLAVVQD PDDAEFASMP RSALNAVKVD HVAPLSELGA       180
     LLASLVDDRA RNHRPTPLAS EDVRRLEVEL GVAREEHALS KGVTRLGAPS PLTCPECHGT       240
     LIEIREGTLV RFRCHSGHAY TAGTLLTEVS ESVESKAYQA LRALGETVIL LRQLSDQRQK       300
     QGDPAGAEAF LARAREVEAS SEGIRALVRT TRALSVEKVE RPDFDG                      346
//

If you have problems or comments...

PBIL Back to PBIL home page