(data stored in ACNUC7421 zone)

EMBL: CP001115.PCAG

CP001115.PCAG        Location/Qualifiers
FT   CDS             complement(233672..234295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="Deide_1p01320"
FT                   /product="putative protocatechuate 3,4-dioxygenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47575"
FT                   /db_xref="GOA:C1D2D6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D6"
FT                   /protein_id="ACO47575.1"
FT                   /translation="MSTERHLPLTPEGSNIPARLFGPSPSQTVGPYFHQGLLYGQDLPE
FT                   AQENILVAPHDDLPGEHITVTGRVLDADGLPVPDALVEIWQAGPQGQTGGHHAFSGFGR
FT                   SDTRRDGGYWLFRTVKPGLVSTPHGTLAPHLQIWLGMRGLLTHLSTRIYFSDEDNTTDP
FT                   VLALVPPDRRPTLIAQREVTPAGPVYRLDFQLQGPQETVFFDAY"
     MSTERHLPLT PEGSNIPARL FGPSPSQTVG PYFHQGLLYG QDLPEAQENI LVAPHDDLPG        60
     EHITVTGRVL DADGLPVPDA LVEIWQAGPQ GQTGGHHAFS GFGRSDTRRD GGYWLFRTVK       120
     PGLVSTPHGT LAPHLQIWLG MRGLLTHLST RIYFSDEDNT TDPVLALVPP DRRPTLIAQR       180
     EVTPAGPVYR LDFQLQGPQE TVFFDAY                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page