(data stored in ACNUC7421 zone)

EMBL: CP001115.PCAH

CP001115.PCAH        Location/Qualifiers
FT   CDS             complement(234285..234998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="Deide_1p01330"
FT                   /product="putative protocatechuate 3,4-dioxygenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47576"
FT                   /db_xref="GOA:C1D2D7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D7"
FT                   /protein_id="ACO47576.1"
FT                   /translation="MTDPQHRPSAHPPHLYPPYTSSIKRAPHELLIPLPAALRDHRGPV
FT                   FGTDRIRPDDHDTTRNARMNGEPLGERIIVRGRLLDSAGRPVRGALIETWQANAAGRYI
FT                   HKQDQHAAPLDPNFTGTGRMLTDEHGEYELISIRPGAYPWRNHHNAWRPAHIHFSVFGT
FT                   NFTQRLVSQMYFPGDPLLAYDPIYQGIPDEKGRQRLISRFDLNITRPEWALGYRFDIVL
FT                   GGEAQTPFEEPDHEH"
     MTDPQHRPSA HPPHLYPPYT SSIKRAPHEL LIPLPAALRD HRGPVFGTDR IRPDDHDTTR        60
     NARMNGEPLG ERIIVRGRLL DSAGRPVRGA LIETWQANAA GRYIHKQDQH AAPLDPNFTG       120
     TGRMLTDEHG EYELISIRPG AYPWRNHHNA WRPAHIHFSV FGTNFTQRLV SQMYFPGDPL       180
     LAYDPIYQGI PDEKGRQRLI SRFDLNITRP EWALGYRFDI VLGGEAQTPF EEPDHEH          237
//

If you have problems or comments...

PBIL Back to PBIL home page