(data stored in ACNUC7421 zone)

EMBL: CP001115.PE101

CP001115.PE101       Location/Qualifiers
FT   CDS             141109..141477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00850"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47490"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D251"
FT                   /protein_id="ACO47490.2"
FT                   /translation="MKSLLLMGLMVTGLAAAQTQGSATIRENGRSYTINCSGNNDVISV
FT                   RGNHNAISLTGICENLVVYGNGNSISGGTLLKVWLRGNDNAVSAPQRTSTPVISNTGKN
FT                   NRYSIGAVTSVSVKKVEK"
     MKSLLLMGLM VTGLAAAQTQ GSATIRENGR SYTINCSGNN DVISVRGNHN AISLTGICEN        60
     LVVYGNGNSI SGGTLLKVWL RGNDNAVSAP QRTSTPVISN TGKNNRYSIG AVTSVSVKKV       120
     EK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page