(data stored in ACNUC7421 zone)

EMBL: CP001115.PE104

CP001115.PE104       Location/Qualifiers
FT   CDS             complement(144011..145381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00880"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47494"
FT                   /db_xref="GOA:C1D255"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D255"
FT                   /protein_id="ACO47494.1"
FT                   /translation="MKRPYWRTLAWRLTLAFVLVSAAALGTVGFISSVYTRSEFSALLG
FT                   AQAQESLTAQVQAYVQANGTVSGFRPSEPHPRNGDRAGPPPRTPGVSRSSWLVLDEQRR
FT                   AVFSTPNVPRGTRVPRPQGTPVTVGNRVVAYLIPSGMRPRPDRRGEDFLSRTAQAIGWS
FT                   MLGATVLAVVMGLLVSRTLLRPLSELRRGIRALQRGDAPIAHQSTRTDEFGEVLHAFGE
FT                   MHQDVVRSQQARRQLTADIAHDLNTPLAVISGTLEAILDGTFKPTSERLKRLHQETQHV
FT                   SQLVNDLRFLSLADAGELHMNHKLAEVEPFIRGAVATFEEMARQGDVTLETHLKVAGVR
FT                   ASVDVVRITQVLQNLLSNALAHTSAGGRVVVTAEVAGQSLTVSVKDTGDGIQPEHLPHV
FT                   FNRLYRADQARSGGGSGLGLSICKTIVEAHGGDIRITSAVGSGTTVTFTLPLPPALS"
     MKRPYWRTLA WRLTLAFVLV SAAALGTVGF ISSVYTRSEF SALLGAQAQE SLTAQVQAYV        60
     QANGTVSGFR PSEPHPRNGD RAGPPPRTPG VSRSSWLVLD EQRRAVFSTP NVPRGTRVPR       120
     PQGTPVTVGN RVVAYLIPSG MRPRPDRRGE DFLSRTAQAI GWSMLGATVL AVVMGLLVSR       180
     TLLRPLSELR RGIRALQRGD APIAHQSTRT DEFGEVLHAF GEMHQDVVRS QQARRQLTAD       240
     IAHDLNTPLA VISGTLEAIL DGTFKPTSER LKRLHQETQH VSQLVNDLRF LSLADAGELH       300
     MNHKLAEVEP FIRGAVATFE EMARQGDVTL ETHLKVAGVR ASVDVVRITQ VLQNLLSNAL       360
     AHTSAGGRVV VTAEVAGQSL TVSVKDTGDG IQPEHLPHVF NRLYRADQAR SGGGSGLGLS       420
     ICKTIVEAHG GDIRITSAVG SGTTVTFTLP LPPALS                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page