(data stored in ACNUC7421 zone)

EMBL: CP001115.PE106

CP001115.PE106       Location/Qualifiers
FT   CDS             complement(146240..146845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00891"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00891"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47496"
FT                   /db_xref="UniProtKB/TrEMBL:C1D257"
FT                   /protein_id="ACO47496.1"
FT                   /translation="MRHTILTPLLALTVLAGTASATSSTSAQRQVAAQAHQRPAEHQAA
FT                   HQNQTRAGDNRGTERPAQTGMHRPDARQGRVTGQHQRGAQAHNPRGMHIQPARPSDQRG
FT                   TSNSPQAQQGGTLNQLGGALRGATRVTFYNGDPLKGAQPTQTIQLTGSPESQATALNRA
FT                   AQQASFAVIERPGGRVVVDLKATSTQPGQPAPRTPRRR"
     MRHTILTPLL ALTVLAGTAS ATSSTSAQRQ VAAQAHQRPA EHQAAHQNQT RAGDNRGTER        60
     PAQTGMHRPD ARQGRVTGQH QRGAQAHNPR GMHIQPARPS DQRGTSNSPQ AQQGGTLNQL       120
     GGALRGATRV TFYNGDPLKG AQPTQTIQLT GSPESQATAL NRAAQQASFA VIERPGGRVV       180
     VDLKATSTQP GQPAPRTPRR R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page