(data stored in ACNUC7421 zone)

EMBL: CP001115.PE107

CP001115.PE107       Location/Qualifiers
FT   CDS             complement(147008..147424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00910"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47497"
FT                   /db_xref="UniProtKB/TrEMBL:C1D258"
FT                   /protein_id="ACO47497.1"
FT                   /translation="MRNLTTLKAFTVSALLTASTLFVNASAAPVFFHNDAGASGIVDIY
FT                   VDGTLVFDDIAPDNAMMFPQELASGRHEVIVTPYNRAPGVQDVLRTTIEIEHASSYHLT
FT                   LGNTSAVYLDELTGELTQAPWTGEPWLSLDTGLN"
     MRNLTTLKAF TVSALLTAST LFVNASAAPV FFHNDAGASG IVDIYVDGTL VFDDIAPDNA        60
     MMFPQELASG RHEVIVTPYN RAPGVQDVLR TTIEIEHASS YHLTLGNTSA VYLDELTGEL       120
     TQAPWTGEPW LSLDTGLN                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page