(data stored in ACNUC7421 zone)

EMBL: CP001115.PE108

CP001115.PE108       Location/Qualifiers
FT   CDS             148405..148911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00914"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00914"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47500"
FT                   /db_xref="UniProtKB/TrEMBL:C1D261"
FT                   /protein_id="ACO47500.1"
FT                   /translation="MNSLYLSATMVLGSLVLSGCEAAERKHYEQRQLTLDRNNAQFYLS
FT                   QCVQAIERRRAQPGVAQGRLPRKLDGTNCENPLLGDYALDPAQGRIIEKSVIRLDSSRL
FT                   SSYTIEVHGRDGEVYTYVDRGRAAAEAEQAGTFADSSAGGTVSPPPDVTEGEPNRPEVE
FT                   ENQSQ"
     MNSLYLSATM VLGSLVLSGC EAAERKHYEQ RQLTLDRNNA QFYLSQCVQA IERRRAQPGV        60
     AQGRLPRKLD GTNCENPLLG DYALDPAQGR IIEKSVIRLD SSRLSSYTIE VHGRDGEVYT       120
     YVDRGRAAAE AEQAGTFADS SAGGTVSPPP DVTEGEPNRP EVEENQSQ                    168
//

If you have problems or comments...

PBIL Back to PBIL home page