(data stored in ACNUC7421 zone)

EMBL: CP001115.PE109

CP001115.PE109       Location/Qualifiers
FT   CDS             150203..150598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00915"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00915"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47501"
FT                   /db_xref="UniProtKB/TrEMBL:C1D262"
FT                   /protein_id="ACO47501.2"
FT                   /translation="MLHPSAEKAVLLPEGFACALFTVAASGEAKRQNMGSLPVMMNGTD
FT                   TPSQGMKHTLINVWPSYAYEAVPNTWARVYQEIKSSSKNGSRLFLRCSLTEFLIAQRHL
FT                   YAIEAESSREAGARRLLYKSRGNKVSL"
     MLHPSAEKAV LLPEGFACAL FTVAASGEAK RQNMGSLPVM MNGTDTPSQG MKHTLINVWP        60
     SYAYEAVPNT WARVYQEIKS SSKNGSRLFL RCSLTEFLIA QRHLYAIEAE SSREAGARRL       120
     LYKSRGNKVS L                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page