(data stored in ACNUC7421 zone)

EMBL: CP001115.PE11

CP001115.PE11        Location/Qualifiers
FT   CDS             complement(11702..12895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00094"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47401"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W2"
FT                   /protein_id="ACO47401.1"
FT                   /translation="MKRLLFLLCLTLPLSSAPLAAAQASAVNDPKLTHAFRTALLDAER
FT                   VWLSTNPDRSFLSVGNDLEYALGWLKSGKYVEAMTPLGLIGAKGADDPFVHLFTAFALA
FT                   GQGKAHEAQGALANAVRRLPALQAYTPTITAYVRAAASPAPSQDAPKPATQPVGPQPSS
FT                   PLNASTVKSMGAALNEAERLWKATRPSTGMFSTNWHVEQILYNLRNQNPEGAKIQIDAA
FT                   RSALKQTAQSETDRAFLDLLDAFAAAQRGQRTLVGQALSALATSPHSTGLKPLTEFLRT
FT                   YQPPKAAPAPVKTPDAKPGGPLMGGSYSCWLERPGINGTRNDVPRGTLTLKTNGTYTYM
FT                   GKGGTYRYNAQTGLLVFTSGFFTNPVPERTTFIKHPRTAQIDIHWAYANDWSCGMNY"
     MKRLLFLLCL TLPLSSAPLA AAQASAVNDP KLTHAFRTAL LDAERVWLST NPDRSFLSVG        60
     NDLEYALGWL KSGKYVEAMT PLGLIGAKGA DDPFVHLFTA FALAGQGKAH EAQGALANAV       120
     RRLPALQAYT PTITAYVRAA ASPAPSQDAP KPATQPVGPQ PSSPLNASTV KSMGAALNEA       180
     ERLWKATRPS TGMFSTNWHV EQILYNLRNQ NPEGAKIQID AARSALKQTA QSETDRAFLD       240
     LLDAFAAAQR GQRTLVGQAL SALATSPHST GLKPLTEFLR TYQPPKAAPA PVKTPDAKPG       300
     GPLMGGSYSC WLERPGINGT RNDVPRGTLT LKTNGTYTYM GKGGTYRYNA QTGLLVFTSG       360
     FFTNPVPERT TFIKHPRTAQ IDIHWAYAND WSCGMNY                                397
//

If you have problems or comments...

PBIL Back to PBIL home page