(data stored in ACNUC7421 zone)

EMBL: CP001115.PE111

CP001115.PE111       Location/Qualifiers
FT   CDS             complement(151198..151410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00918"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00918"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47503"
FT                   /db_xref="GOA:C1D264"
FT                   /db_xref="UniProtKB/TrEMBL:C1D264"
FT                   /protein_id="ACO47503.1"
FT                   /translation="MGFFDPHAVSLLFRRPRVGLLLNVAIIVSDIIVNSFVQHGALLVL
FT                   SSAFQGLQAQTAFLGFVLGIRVSVR"
     MGFFDPHAVS LLFRRPRVGL LLNVAIIVSD IIVNSFVQHG ALLVLSSAFQ GLQAQTAFLG        60
     FVLGIRVSVR                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page