(data stored in ACNUC7421 zone)

EMBL: CP001115.PE112

CP001115.PE112       Location/Qualifiers
FT   CDS             complement(151444..151746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00917"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00917"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47504"
FT                   /db_xref="GOA:C1D265"
FT                   /db_xref="UniProtKB/TrEMBL:C1D265"
FT                   /protein_id="ACO47504.1"
FT                   /translation="MFGFYWCAERGQQEPLQNTTGDGTSLRETLPAKSALYPTGSHGAF
FT                   PARSEHAMAAPGRLRRYKGMTLLTSVSIIIYAASLVGTTYNHVTDLWYKGCLPYD"
     MFGFYWCAER GQQEPLQNTT GDGTSLRETL PAKSALYPTG SHGAFPARSE HAMAAPGRLR        60
     RYKGMTLLTS VSIIIYAASL VGTTYNHVTD LWYKGCLPYD                             100
//

If you have problems or comments...

PBIL Back to PBIL home page