(data stored in ACNUC7421 zone)

EMBL: CP001115.PE12

CP001115.PE12        Location/Qualifiers
FT   CDS             complement(12945..13310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00095"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47402"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W3"
FT                   /protein_id="ACO47402.1"
FT                   /translation="MLLVSGDGEMPIVNPSEVRKYPGLKQGTVTTTSPGPAPTRFWFNS
FT                   LAYTYVPRSGNDLCSSQSFNHGKPGSTPERTSRIVVSLVQSVVDQWRCCALLQWPMIQT
FT                   ISSQDHLLEMHSSVSEA"
     MLLVSGDGEM PIVNPSEVRK YPGLKQGTVT TTSPGPAPTR FWFNSLAYTY VPRSGNDLCS        60
     SQSFNHGKPG STPERTSRIV VSLVQSVVDQ WRCCALLQWP MIQTISSQDH LLEMHSSVSE       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page