(data stored in ACNUC7421 zone)

EMBL: CP001115.PE121

CP001115.PE121       Location/Qualifiers
FT   CDS             complement(167533..167820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00985"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26552"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN76"
FT                   /protein_id="AHX26552.1"
FT                   /translation="MIPLSCGGATYEAEVRGNGTYTSGHITGSNSNLIPFGFGGQFIDR
FT                   ATGVSYSFMESKGGNRIGLQRSLMTCTLSYEDEMVSGQLTVTVFMTPGGK"
     MIPLSCGGAT YEAEVRGNGT YTSGHITGSN SNLIPFGFGG QFIDRATGVS YSFMESKGGN        60
     RIGLQRSLMT CTLSYEDEMV SGQLTVTVFM TPGGK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page