(data stored in ACNUC7421 zone)

EMBL: CP001115.PE122

CP001115.PE122       Location/Qualifiers
FT   CDS             168049..168438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00991"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47512"
FT                   /db_xref="UniProtKB/TrEMBL:C1D273"
FT                   /protein_id="ACO47512.1"
FT                   /translation="MTVWYLHFCLGKMGSTEDDVTLLCQGHPEGGIADTMDEVRQVCSP
FT                   LELMTAGRSSGRGTSNALPSCSAFPTSPVTAEKLKSRAVTVPSLLLNPSRVGCPPTARP
FT                   MARWNFREDVRSIAELRVQGAVFQQ"
     MTVWYLHFCL GKMGSTEDDV TLLCQGHPEG GIADTMDEVR QVCSPLELMT AGRSSGRGTS        60
     NALPSCSAFP TSPVTAEKLK SRAVTVPSLL LNPSRVGCPP TARPMARWNF REDVRSIAEL       120
     RVQGAVFQQ                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page