(data stored in ACNUC7421 zone)

EMBL: CP001115.PE123

CP001115.PE123       Location/Qualifiers
FT   CDS             168602..168934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00992"
FT                   /product="putative rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00992"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47513"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1D274"
FT                   /protein_id="ACO47513.2"
FT                   /translation="MKRLTPKELNTLNSSRKAPVTVDVRSSEEFEAGHVDGALNIPITD
FT                   LPQRLGELPKDRPVVTYCNMFHPGASRGEKAAAQLLELGFDAGVLEGGYPAWKDAGAAD
FT                   PAPENK"
     MKRLTPKELN TLNSSRKAPV TVDVRSSEEF EAGHVDGALN IPITDLPQRL GELPKDRPVV        60
     TYCNMFHPGA SRGEKAAAQL LELGFDAGVL EGGYPAWKDA GAADPAPENK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page