(data stored in ACNUC7421 zone)

EMBL: CP001115.PE124

CP001115.PE124       Location/Qualifiers
FT   CDS             170367..170777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00994"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00994"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47515"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:C1D276"
FT                   /protein_id="ACO47515.1"
FT                   /translation="MALALFLSVPLVAAAQSAVPLSGIIGWTGRFTSLTRPTSGTVVVF
FT                   QNRDGRTHLLLHRFKTQSDQNLQVWLYKNVPRRGDQNLAPSGSALKLGELTQFGGDFEF
FT                   ALPSGVDMLAGYKSVVIWNDQVKRVFGVAPLE"
     MALALFLSVP LVAAAQSAVP LSGIIGWTGR FTSLTRPTSG TVVVFQNRDG RTHLLLHRFK        60
     TQSDQNLQVW LYKNVPRRGD QNLAPSGSAL KLGELTQFGG DFEFALPSGV DMLAGYKSVV       120
     IWNDQVKRVF GVAPLE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page