(data stored in ACNUC7421 zone)

EMBL: CP001115.PE126

CP001115.PE126       Location/Qualifiers
FT   CDS             172209..172547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00997"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00997"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47517"
FT                   /db_xref="UniProtKB/TrEMBL:C1D278"
FT                   /protein_id="ACO47517.1"
FT                   /translation="MCGKKRLAYAWRRVRRRPLTARLRKCMFNGQPLDKAAASKASCNT
FT                   DSAIGWISGVPEVGQGASEPGGGGVTQISSRANVHPGRRGKGQQFSPRPFRGIDFSSSG
FT                   TTAVDVGA"
     MCGKKRLAYA WRRVRRRPLT ARLRKCMFNG QPLDKAAASK ASCNTDSAIG WISGVPEVGQ        60
     GASEPGGGGV TQISSRANVH PGRRGKGQQF SPRPFRGIDF SSSGTTAVDV GA               112
//

If you have problems or comments...

PBIL Back to PBIL home page