(data stored in ACNUC7421 zone)

EMBL: CP001115.PE127

CP001115.PE127       Location/Qualifiers
FT   CDS             172766..173236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01000"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47518"
FT                   /db_xref="GOA:C1D279"
FT                   /db_xref="UniProtKB/TrEMBL:C1D279"
FT                   /protein_id="ACO47518.1"
FT                   /translation="MHNAPMYVTLRNTLSSLGITLGLPVMVLSPNLFWTQFSLADHLGE
FT                   GSVGITRAYVLAMLVPVAYGLWDALTRRDRSILGLYAMGRTLIGGAAASGLWTASGTRS
FT                   KPQWMCSCRRWCSWGVRCLEGHCLNPSSSKGSSSRCRQRSVTHCKKPWSTAV"
     MHNAPMYVTL RNTLSSLGIT LGLPVMVLSP NLFWTQFSLA DHLGEGSVGI TRAYVLAMLV        60
     PVAYGLWDAL TRRDRSILGL YAMGRTLIGG AAASGLWTAS GTRSKPQWMC SCRRWCSWGV       120
     RCLEGHCLNP SSSKGSSSRC RQRSVTHCKK PWSTAV                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page