(data stored in ACNUC7421 zone)

EMBL: CP001115.PE128

CP001115.PE128       Location/Qualifiers
FT   CDS             173086..173538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01001"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01001"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47519"
FT                   /db_xref="GOA:C1D280"
FT                   /db_xref="UniProtKB/TrEMBL:C1D280"
FT                   /protein_id="ACO47519.1"
FT                   /translation="MDVFLQALVFLGSAVFGRPLLKPLIVEGLIKQVPAAQRHALQEAL
FT                   EHRGMTRAYWLSGVIAGVWKLMFGGLRMLVAYSVVTAPFGTATFNAQVAVLMTVMYLPG
FT                   LLMGAIVLAPAMLLVDRTVKRIYGPDVTLMRSEGLHSFARNLTPAT"
     MDVFLQALVF LGSAVFGRPL LKPLIVEGLI KQVPAAQRHA LQEALEHRGM TRAYWLSGVI        60
     AGVWKLMFGG LRMLVAYSVV TAPFGTATFN AQVAVLMTVM YLPGLLMGAI VLAPAMLLVD       120
     RTVKRIYGPD VTLMRSEGLH SFARNLTPAT                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page