(data stored in ACNUC7421 zone)

EMBL: CP001115.PE130

CP001115.PE130       Location/Qualifiers
FT   CDS             complement(175841..176494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47521"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C1D282"
FT                   /protein_id="ACO47521.1"
FT                   /translation="MCGIHESDQQKDQLEETSISRRTIIRGLLLTAGAAQATALAGGAG
FT                   PLASNAAGVIRAWPQASREVAMKMIARYGQPHEFTVSMLIWHNHGPWKRTIVNRDTVPH
FT                   RFPMPHQDMLEQFVDYRVPLERYDDLAHYDGSVIVERTKGEMSARCDKEEMNMLALNLA
FT                   HDISMGRRTWQDARDFYARTAMAFMQGQTSPYTQSLMFKAARGTTADPDQPADM"
     MCGIHESDQQ KDQLEETSIS RRTIIRGLLL TAGAAQATAL AGGAGPLASN AAGVIRAWPQ        60
     ASREVAMKMI ARYGQPHEFT VSMLIWHNHG PWKRTIVNRD TVPHRFPMPH QDMLEQFVDY       120
     RVPLERYDDL AHYDGSVIVE RTKGEMSARC DKEEMNMLAL NLAHDISMGR RTWQDARDFY       180
     ARTAMAFMQG QTSPYTQSLM FKAARGTTAD PDQPADM                                217
//

If you have problems or comments...

PBIL Back to PBIL home page