(data stored in ACNUC7421 zone)

EMBL: CP001115.PE132

CP001115.PE132       Location/Qualifiers
FT   CDS             179157..179411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01027"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26553"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5U5"
FT                   /protein_id="AHX26553.1"
FT                   /translation="MRNTPDFKSLYMPFDALLFFGDLGDGDLVGSIEQRHTRMNMRLDR
FT                   GWNALIRIHRWTGREGKTSLSEVTWVALSPAVMERWIVR"
     MRNTPDFKSL YMPFDALLFF GDLGDGDLVG SIEQRHTRMN MRLDRGWNAL IRIHRWTGRE        60
     GKTSLSEVTW VALSPAVMER WIVR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page