(data stored in ACNUC7421 zone)

EMBL: CP001115.PE133

CP001115.PE133       Location/Qualifiers
FT   CDS             180181..180882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01030"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47525"
FT                   /db_xref="GOA:C1D286"
FT                   /db_xref="UniProtKB/TrEMBL:C1D286"
FT                   /protein_id="ACO47525.1"
FT                   /translation="MTSTAPSSLTESTGSAKHSVRSHLLLPFVAYFLMLASTSFIAGGI
FT                   VHLGLGENTTFYMALAAVGVVCFTAGNYLQEYVIRKNERGTALGKFLLVSFVLSVGIGM
FT                   MTGGVQHFLDNPPYSTILIPSGLLLAVTAFAMREGLTLGRKVTQLISGTLAVAALLFGG
FT                   LSALSTSVSAPAAHGHGAAAEEVTPNVSAAQHSAVDAPETAATPVEAEEAAHPVTDAAD
FT                   GHESEDSHAGH"
     MTSTAPSSLT ESTGSAKHSV RSHLLLPFVA YFLMLASTSF IAGGIVHLGL GENTTFYMAL        60
     AAVGVVCFTA GNYLQEYVIR KNERGTALGK FLLVSFVLSV GIGMMTGGVQ HFLDNPPYST       120
     ILIPSGLLLA VTAFAMREGL TLGRKVTQLI SGTLAVAALL FGGLSALSTS VSAPAAHGHG       180
     AAAEEVTPNV SAAQHSAVDA PETAATPVEA EEAAHPVTDA ADGHESEDSH AGH              233
//

If you have problems or comments...

PBIL Back to PBIL home page