(data stored in ACNUC7421 zone)

EMBL: CP001115.PE136

CP001115.PE136       Location/Qualifiers
FT   CDS             complement(182764..183069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01050"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47527"
FT                   /db_xref="UniProtKB/TrEMBL:C1D288"
FT                   /protein_id="ACO47527.1"
FT                   /translation="MEDAAALLMSEWRYDTHPPYQSEKRTMSAAFEITQEDLRAALDRL
FT                   NLPADETTLERAAEVAFAENERITKAALCGEHLEEQTRCGMDELVAVLSETLGAGG"
     MEDAAALLMS EWRYDTHPPY QSEKRTMSAA FEITQEDLRA ALDRLNLPAD ETTLERAAEV        60
     AFAENERITK AALCGEHLEE QTRCGMDELV AVLSETLGAG G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page