(data stored in ACNUC7421 zone)

EMBL: CP001115.PE137

CP001115.PE137       Location/Qualifiers
FT   CDS             183318..183950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01055"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01055"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26555"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5P1"
FT                   /protein_id="AHX26555.1"
FT                   /translation="MHRQWVLPCFTLFVICSGALAQQGPAATSSLLGVPLAPGAIRITD
FT                   AAATREFAGPLRNVASSQSAACTTSEFLVWEGDVGDQVSGSLATQLTARQLTLKVLEAT
FT                   DTEDSASLSFVLTGREGRHAGVMYAGSNSVVLGWCRLAARPTASVPSGLKPAQAPKPAA
FT                   LATAKTSAPPVGDYSCLNADSLVYAFKLSILPGMKYRCKAVRSGRLP"
     MHRQWVLPCF TLFVICSGAL AQQGPAATSS LLGVPLAPGA IRITDAAATR EFAGPLRNVA        60
     SSQSAACTTS EFLVWEGDVG DQVSGSLATQ LTARQLTLKV LEATDTEDSA SLSFVLTGRE       120
     GRHAGVMYAG SNSVVLGWCR LAARPTASVP SGLKPAQAPK PAALATAKTS APPVGDYSCL       180
     NADSLVYAFK LSILPGMKYR CKAVRSGRLP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page