(data stored in ACNUC7421 zone)

EMBL: CP001115.PE138

CP001115.PE138       Location/Qualifiers
FT   CDS             184080..184505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01060"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47528"
FT                   /db_xref="GOA:C1D289"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C1D289"
FT                   /protein_id="ACO47528.1"
FT                   /translation="MWAAFLTELAQPDVTHVMVRAHDGYQACVPLEELMHTDVLLADHM
FT                   NGKPLTPAHGAPLRLIAPQLYGYKSIKHLRRLELLPAPVASPVGRIVSHPRGRVNPEER
FT                   SAVGASHFWRWVYRMQVGGHLRGARALSEQNRRIVRP"
     MWAAFLTELA QPDVTHVMVR AHDGYQACVP LEELMHTDVL LADHMNGKPL TPAHGAPLRL        60
     IAPQLYGYKS IKHLRRLELL PAPVASPVGR IVSHPRGRVN PEERSAVGAS HFWRWVYRMQ       120
     VGGHLRGARA LSEQNRRIVR P                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page