(data stored in ACNUC7421 zone)

EMBL: CP001115.PE139

CP001115.PE139       Location/Qualifiers
FT   CDS             complement(185027..186304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01070"
FT                   /product="putative major facilitator superfamily MFS_1;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47529"
FT                   /db_xref="GOA:C1D290"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D290"
FT                   /protein_id="ACO47529.1"
FT                   /translation="MTTPAASPDAFAALRFADFRRLLVSSASASFAGTAFSVVIGYQVY
FT                   ALTKSPLILGLLGVATALPTLSLALLGGHYADRLDRRRILLVTRALLVLSGLAFAGLSL
FT                   AGPATSVTGLFLLVVLMGFARGFGDPASSAFETRIVPARVYVNASAWLGSVGQVAGILG
FT                   PVLAGLFLTRFEASGTYMLMATLYATSWFALRRMPRIPPVMTVSEEGMRESIQGGLRFV
FT                   RKDPVLFGSMALDLLAVLFGGAVALLPVFASDILKVSPSGLGMLMAAPSVGALLVMLWM
FT                   TRKPPLHRTGVWLVLSIAGFGLAMLVFGVSRTFWLSWTALAFSGVFDGVNMLIRRAIVR
FT                   TRTPDHMRGRVGSVSLVFIGTSNEIGALESGVAAHYLGVVRATALGGLITLAIAGGAAW
FT                   RWRDLMAWELRHEQAYHSDTSGVDST"
     MTTPAASPDA FAALRFADFR RLLVSSASAS FAGTAFSVVI GYQVYALTKS PLILGLLGVA        60
     TALPTLSLAL LGGHYADRLD RRRILLVTRA LLVLSGLAFA GLSLAGPATS VTGLFLLVVL       120
     MGFARGFGDP ASSAFETRIV PARVYVNASA WLGSVGQVAG ILGPVLAGLF LTRFEASGTY       180
     MLMATLYATS WFALRRMPRI PPVMTVSEEG MRESIQGGLR FVRKDPVLFG SMALDLLAVL       240
     FGGAVALLPV FASDILKVSP SGLGMLMAAP SVGALLVMLW MTRKPPLHRT GVWLVLSIAG       300
     FGLAMLVFGV SRTFWLSWTA LAFSGVFDGV NMLIRRAIVR TRTPDHMRGR VGSVSLVFIG       360
     TSNEIGALES GVAAHYLGVV RATALGGLIT LAIAGGAAWR WRDLMAWELR HEQAYHSDTS       420
     GVDST                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page