(data stored in ACNUC7421 zone)

EMBL: CP001115.PE14

CP001115.PE14        Location/Qualifiers
FT   CDS             22902..23384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00110"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47404"
FT                   /db_xref="GOA:C1D1W5"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W5"
FT                   /protein_id="ACO47404.1"
FT                   /translation="MTLPEFFTTLLTELAWNLAVWLPTALVSLLFIRAVLGVRMRELIV
FT                   EIEEHQTAAIGAVFFWVSLGFSLLLSRTIADPVAAGGGTWAEAFAWLALAVLVTMLLFA
FT                   LGVFLVFGTLARRRKESLLGYIRREMRHEHNLALSFIMGALFLVPVVVTYHLTLSS"
     MTLPEFFTTL LTELAWNLAV WLPTALVSLL FIRAVLGVRM RELIVEIEEH QTAAIGAVFF        60
     WVSLGFSLLL SRTIADPVAA GGGTWAEAFA WLALAVLVTM LLFALGVFLV FGTLARRRKE       120
     SLLGYIRREM RHEHNLALSF IMGALFLVPV VVTYHLTLSS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page