(data stored in ACNUC7421 zone)

EMBL: CP001115.PE140

CP001115.PE140       Location/Qualifiers
FT   CDS             187049..187438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01071"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47530"
FT                   /db_xref="UniProtKB/TrEMBL:C1D291"
FT                   /protein_id="ACO47530.1"
FT                   /translation="MSWNCSVMRSKRSRGYWGCQPPTSKGIVGAWPSAAVPPKTAGRQK
FT                   VHRLCTARDEPFQTASHGLDSAAFLSEMEDLPLYLRPSALFTGSTPTGTADLASQDRGL
FT                   RARLERGRCGVKAGSGKGSIGMSAS"
     MSWNCSVMRS KRSRGYWGCQ PPTSKGIVGA WPSAAVPPKT AGRQKVHRLC TARDEPFQTA        60
     SHGLDSAAFL SEMEDLPLYL RPSALFTGST PTGTADLASQ DRGLRARLER GRCGVKAGSG       120
     KGSIGMSAS                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page