(data stored in ACNUC7421 zone)

EMBL: CP001115.PE143

CP001115.PE143       Location/Qualifiers
FT   CDS             complement(188526..188714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01076"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01076"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47534"
FT                   /db_xref="GOA:C1D295"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C1D295"
FT                   /protein_id="ACO47534.1"
FT                   /translation="MVQAVRSVKSVGLSDLGTLSVRENAARTDVRPSTSRKIQDGHLVE
FT                   KYGRANKELGYPQNLCR"
     MVQAVRSVKS VGLSDLGTLS VRENAARTDV RPSTSRKIQD GHLVEKYGRA NKELGYPQNL        60
     CR                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page