(data stored in ACNUC7421 zone)

EMBL: CP001115.PE145

CP001115.PE145       Location/Qualifiers
FT   CDS             complement(191876..193762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01090"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47537"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1D298"
FT                   /protein_id="ACO47537.1"
FT                   /translation="MRRPSFALLAITLTLSLVACPRSTTAAERQTSGSQAITGDTVTGV
FT                   DPAVEPAPGKVVGKATAEGSQSVAGSPQRPPAPESSAAAAPEAASASADVVRSTQEKVK
FT                   AEAQVVKPAPVEVRPATAASTPMRPTPQVTAEARRPAVPVTQASQAKPAVTEPTVVKPS
FT                   PLKAASAQPVQSKSAPAKSVPTKSAPPTPAPARPAPMITSPVETVSAPVASKAVEPAPV
FT                   KPAVIKSVQKPAATHQVAESRRAPGPLQTGPAMRGLWVDAFGPGFKTPGEVDRLIADAR
FT                   AMNINTLFVQAVKRGDCYCNGSLLPRTEDPAVPAEFDPLADVLTKAHAHGIKVHAWVIP
FT                   TAVSNRAVRYPVTNPEHVVNAHGEGDEQDWLMRNSGGSMWAGNDQQLDIGHPDARRYMV
FT                   DAIQSVAAAYNIDGVQLDRVRYPDPSGTVQDWGYNPGAVAAYQAESETTETPAPGDARW
FT                   TAWRREQVNALVSEVSGAVRSARPGTVISVAAITYGAGPRTREAFASTRTYAEVLQDWP
FT                   LWLADGNVDLVVLMNYKREAHAGQARDFDSWNRFAKSVKAGGQVAAGTALYLNTAQENL
FT                   VQVRRAVEQGLDGWVGYSYRTPELGVEEGRKAGDKAYRELRSLLVGESAARH"
     MRRPSFALLA ITLTLSLVAC PRSTTAAERQ TSGSQAITGD TVTGVDPAVE PAPGKVVGKA        60
     TAEGSQSVAG SPQRPPAPES SAAAAPEAAS ASADVVRSTQ EKVKAEAQVV KPAPVEVRPA       120
     TAASTPMRPT PQVTAEARRP AVPVTQASQA KPAVTEPTVV KPSPLKAASA QPVQSKSAPA       180
     KSVPTKSAPP TPAPARPAPM ITSPVETVSA PVASKAVEPA PVKPAVIKSV QKPAATHQVA       240
     ESRRAPGPLQ TGPAMRGLWV DAFGPGFKTP GEVDRLIADA RAMNINTLFV QAVKRGDCYC       300
     NGSLLPRTED PAVPAEFDPL ADVLTKAHAH GIKVHAWVIP TAVSNRAVRY PVTNPEHVVN       360
     AHGEGDEQDW LMRNSGGSMW AGNDQQLDIG HPDARRYMVD AIQSVAAAYN IDGVQLDRVR       420
     YPDPSGTVQD WGYNPGAVAA YQAESETTET PAPGDARWTA WRREQVNALV SEVSGAVRSA       480
     RPGTVISVAA ITYGAGPRTR EAFASTRTYA EVLQDWPLWL ADGNVDLVVL MNYKREAHAG       540
     QARDFDSWNR FAKSVKAGGQ VAAGTALYLN TAQENLVQVR RAVEQGLDGW VGYSYRTPEL       600
     GVEEGRKAGD KAYRELRSLL VGESAARH                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page