(data stored in ACNUC7421 zone)

EMBL: CP001115.PE146

CP001115.PE146       Location/Qualifiers
FT   CDS             194572..195231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01096"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01096"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26556"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLK7"
FT                   /protein_id="AHX26556.1"
FT                   /translation="MKPGPLLAVILSALLSACAPGGINQLKFQPAPEGARISAPRLLIE
FT                   QRVPATQLVSVRDAVDRAPVGSLIVVCSERWSAARPWGICTHVTRKLGPDEFTDAPGIF
FT                   VGGLFGGGPQITPARTLFQRDVVIVLDVGVRNHHLNVLRATARKLAGTPYRVAGLLDRD
FT                   GGLDCSTYQNELQRAMGLADAVPFNGLWNLYLPQDALTAPGAQVLWVGVRTLPSKP"
     MKPGPLLAVI LSALLSACAP GGINQLKFQP APEGARISAP RLLIEQRVPA TQLVSVRDAV        60
     DRAPVGSLIV VCSERWSAAR PWGICTHVTR KLGPDEFTDA PGIFVGGLFG GGPQITPART       120
     LFQRDVVIVL DVGVRNHHLN VLRATARKLA GTPYRVAGLL DRDGGLDCST YQNELQRAMG       180
     LADAVPFNGL WNLYLPQDAL TAPGAQVLWV GVRTLPSKP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page