(data stored in ACNUC7421 zone)

EMBL: CP001115.PE148

CP001115.PE148       Location/Qualifiers
FT   CDS             complement(196984..198987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01110"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47540"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A1"
FT                   /protein_id="ACO47540.2"
FT                   /translation="MARLRTPAGHSLEPATTSFAVREMQAAYIDPPGGITAHPDVLEVV
FT                   LRTMDEVLSEVMHQAEHDEALSPQQQGELIGGVQLGQTLAVALRGYAADPTAERLEMVN
FT                   DLTVTLAQRHVLGNFMMARLPAINAASVLREMTPVPLLEVEFNQATRVVLDAHDQDVGE
FT                   TALLRLTWAGYRAPGLPKNPWAPSRAELTPRPTMDPTRFGWDQELKAIARSPHPAERHA
FT                   ALLLLHINGRDRAENLPLVQVLDQTSVLLYDLQRLARRERNAFPALDQLMTVHDGLAAE
FT                   LGHPDLSMTRRHKRSAAEPHTHDRTAQRLLRALRYERHRTATAAEQGQQARLWEALNQL
FT                   EQELQAGMTPDQDEALKVRLLLLGLQGLTSTYRAPGMNLPVMVQLAAQVSGLDPLWAWQ
FT                   RTQPGDADAPVLRELLAALEDSLFLTALQRSPDWPAWAPRIRRSVTLAAGHLLATVRRR
FT                   GLRLPDQTFLETWFATFGPLRATPLTHHELEAADRERTALILETHGALQTLLKPSDGLP
FT                   ESVVEALEPVRTSTPAAPEPAAVQPLPAALPHIQAARDLLRGRRMVLLGGVPSPHHHAA
FT                   LVEALALEDLDWIGSDQYAHGTHAQSHIRPGTALVVLAIRWMAHAHNTLRDVARERGVP
FT                   YVMHPGGLSPSSVAWQILQQASRQLAPDRPAF"
     MARLRTPAGH SLEPATTSFA VREMQAAYID PPGGITAHPD VLEVVLRTMD EVLSEVMHQA        60
     EHDEALSPQQ QGELIGGVQL GQTLAVALRG YAADPTAERL EMVNDLTVTL AQRHVLGNFM       120
     MARLPAINAA SVLREMTPVP LLEVEFNQAT RVVLDAHDQD VGETALLRLT WAGYRAPGLP       180
     KNPWAPSRAE LTPRPTMDPT RFGWDQELKA IARSPHPAER HAALLLLHIN GRDRAENLPL       240
     VQVLDQTSVL LYDLQRLARR ERNAFPALDQ LMTVHDGLAA ELGHPDLSMT RRHKRSAAEP       300
     HTHDRTAQRL LRALRYERHR TATAAEQGQQ ARLWEALNQL EQELQAGMTP DQDEALKVRL       360
     LLLGLQGLTS TYRAPGMNLP VMVQLAAQVS GLDPLWAWQR TQPGDADAPV LRELLAALED       420
     SLFLTALQRS PDWPAWAPRI RRSVTLAAGH LLATVRRRGL RLPDQTFLET WFATFGPLRA       480
     TPLTHHELEA ADRERTALIL ETHGALQTLL KPSDGLPESV VEALEPVRTS TPAAPEPAAV       540
     QPLPAALPHI QAARDLLRGR RMVLLGGVPS PHHHAALVEA LALEDLDWIG SDQYAHGTHA       600
     QSHIRPGTAL VVLAIRWMAH AHNTLRDVAR ERGVPYVMHP GGLSPSSVAW QILQQASRQL       660
     APDRPAF                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page