(data stored in ACNUC7421 zone)

EMBL: CP001115.PE153

CP001115.PE153       Location/Qualifiers
FT   CDS             203897..204553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01141"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2A8"
FT                   /protein_id="ACO47547.1"
FT                   /translation="MRMPTLHLIVGLPCAGKTTYSKQLERDQPALRLTLDDWHIRLFGH
FT                   DFTLDFVHPEHDARHQVIEKMMWDVAARALQLGNDVILDFGFWAKSERDDYRTRAAALG
FT                   ADSVVHYLHAPEAVLLSRLADRNARQPQGTFQIPPQNCWSGCTCSKLRRKTNPRTSLLL
FT                   NFAEMLTCRRMLNFHRAPPASPSSQRLRPSGLMPTPARWWTGDHLACRELHPQAG"
     MRMPTLHLIV GLPCAGKTTY SKQLERDQPA LRLTLDDWHI RLFGHDFTLD FVHPEHDARH        60
     QVIEKMMWDV AARALQLGND VILDFGFWAK SERDDYRTRA AALGADSVVH YLHAPEAVLL       120
     SRLADRNARQ PQGTFQIPPQ NCWSGCTCSK LRRKTNPRTS LLLNFAEMLT CRRMLNFHRA       180
     PPASPSSQRL RPSGLMPTPA RWWTGDHLAC RELHPQAG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page