(data stored in ACNUC7421 zone)

EMBL: CP001115.PE165

CP001115.PE165       Location/Qualifiers
FT   CDS             complement(218076..218432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01252"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01252"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47561"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C2"
FT                   /protein_id="ACO47561.1"
FT                   /translation="MLLAPLHNGLFTCKIYATSLRVRGPSTYKKRNQKGIRARNETVYS
FT                   QKGSITGIESCIDLSPNSLYCFSNVPVCCGNRSFSNQVSLFRTGSGLAMAIRTGKSSTA
FT                   RELTLLVSAQGAPA"
     MLLAPLHNGL FTCKIYATSL RVRGPSTYKK RNQKGIRARN ETVYSQKGSI TGIESCIDLS        60
     PNSLYCFSNV PVCCGNRSFS NQVSLFRTGS GLAMAIRTGK SSTARELTLL VSAQGAPA         118
//

If you have problems or comments...

PBIL Back to PBIL home page